Germany
Japan
United Kingdom
China
Anti-TPBG Reference Antibody (PF-06263507)
| Applications | Animal Model, ELISA, FACS, FN, Kinetics |
| Reactivities | Human, Cynomolgus |
| Conjugation | Unconjugated |
Antibodies
View as table DownloadAnti-TPBG Reference Antibody (naptumomAb)
| Applications | Animal Model, ELISA, FACS, FN, Kinetics |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-TPBG Reference Antibody (ASN004)
| Applications | Animal Model, ELISA, FACS, FN, Kinetics |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-TPBG Reference Antibody (Wyeth patent anti-5T4)
| Applications | Animal Model, ELISA, FACS, FN, Kinetics |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Tpbg Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tpbg antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tpbg. Synthetic peptide located within the following region: GDGRLRLARLALVLLGWVSASAPSSSVPSSSTSPAAFLASGSAQPPPAER |
5T4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 32-350 of human 5T4 (NP_006661.1). |
| Modifications | Unmodified |
Active filters
Category
- Antibodies
Target Symbol
- TPBG