Rabbit Polyclonal ZBTB9 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ZBTB9 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human ZBTB9. |
Rabbit Polyclonal ZBTB9 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ZBTB9 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human ZBTB9. |
Rabbit Polyclonal Anti-ZBTB9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZBTB9 antibody: synthetic peptide directed towards the N terminal of human ZBTB9. Synthetic peptide located within the following region: METPTPLPPVPASPTCNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDV |
Rabbit Polyclonal Anti-ZBTB9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZBTB9 antibody: synthetic peptide directed towards the C terminal of human ZBTB9. Synthetic peptide located within the following region: HHLTEHMKTHAGALHACPHCGRRFRVHACFLRHRDLCKGQGWATAHWTYK |