Goat Polyclonal Antibody against SIRT4
| Applications | IHC, PEP-ELISA, WB |
| Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SRCGELLPLIDPC, from the C Terminus of the protein sequence according to NP_036372.1. |
Rabbit Polyclonal Anti-SIRT4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIRT4 antibody: synthetic peptide directed towards the middle region of human SIRT4. Synthetic peptide located within the following region: QVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQV |
Rabbit Polyclonal Anti-SIRT4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIRT4 antibody: synthetic peptide directed towards the N terminal of human SIRT4. Synthetic peptide located within the following region: ASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYAR |
Chicken Polyclonal SIRT4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SIRT4 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human SIRT4. |
SIRT4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 29-260 of human SIRT4 (NP_036372.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
