Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MS4A4A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MS4A4A antibody: synthetic peptide directed towards the N terminal of human MS4A4A. Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL |
Recombinant Anti-MS4A4A (Clone 5C12)
| Applications | FC, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-MS4A4A (Clone 5C12)
| Applications | FC, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-MS4A4A (Clone 3F2)
| Applications | FC, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-MS4A4A (Clone 3F2)
| Applications | FC, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |