USD 535.00
2 Weeks
myosin heavy chain 9 (MYH9) mouse monoclonal antibody, clone 2B3, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 535.00
2 Weeks
myosin heavy chain 9 (MYH9) mouse monoclonal antibody, clone 2B3, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 535.00
2 Weeks
myosin heavy chain 9 (MYH9) mouse monoclonal antibody, clone 4H3, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MYH9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYH9 antibody: synthetic peptide directed towards the middle region of human MYH9. Synthetic peptide located within the following region: DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK |