Antibodies

View as table Download

Rabbit Polyclonal Anti-GLO1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GLO1

Rabbit Polyclonal antibody to Glyoxalase I (glyoxalase I)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Xenopus, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 184 of Glyoxalase I (Uniprot ID#Q04760)

Mouse Monoclonal GLO1 Antibody (Glo1a)

Applications ELISA, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human
Conjugation Unconjugated

Rabbit anti-GLO1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GLO1

Rabbit Polyclonal Anti-GLO1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLO1 antibody: synthetic peptide directed towards the N terminal of human GLO1. Synthetic peptide located within the following region: TMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKE

GLO1 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human GLO1