Antibodies

Jump to Filters
View as table Download
IPPK Rabbit Polyclonal Antibody
TA315745

USD 380.00

In Stock

Rabbit polyclonal anti-IPPK antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IPPK.
IPPK Rabbit Polyclonal Antibody
TA344669

USD 539.00

5 Days

Rabbit Polyclonal Anti-Ippk Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ippk antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQGTS