Antibodies

View as table Download

Anti-AP1B1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-30 amino acids of Human Adapter-related protein complex 1 subunit beta-1

Anti-AP1B1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-30 amino acids of Human Adapter-related protein complex 1 subunit beta-1

Rabbit Polyclonal Anti-AP1B1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human AP1B1

Rabbit polyclonal antibody to beta-Adaptin (adaptor-related protein complex 1, beta 1 subunit)

Applications WB
Reactivities Human, Mouse (Predicted: Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 384 and 609 of beta-Adaptin (Uniprot ID#Q10567)

Rabbit Polyclonal Anti-AP1B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AP1B1 antibody: synthetic peptide directed towards the C terminal of human AP1B1. Synthetic peptide located within the following region: KLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKE