Antibodies

View as table Download

Rabbit polyclonal anti-MTFMT antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTFMT antibody: synthetic peptide directed towards the C terminal of human MTFMT. Synthetic peptide located within the following region: SVMLKKSLTATDFYNGYLHPWYQKNSQAQPSQCRFQTLRLPTKKKQKKTV

MTFMT mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications WB
Reactivities Human
Conjugation Unconjugated

MTFMT mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications WB
Reactivities Human
Conjugation Unconjugated

MTFMT mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)

Applications WB
Reactivities Human
Conjugation Unconjugated

MTFMT mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications WB
Reactivities Human
Conjugation Unconjugated

MTFMT mouse monoclonal antibody, clone OTI2A2 (formerly 2A2)

Applications WB
Reactivities Human
Conjugation Unconjugated