OXSM mouse monoclonal antibody,clone 3A4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
OXSM mouse monoclonal antibody,clone 3A4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
OXSM rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human OXSM |
OXSM mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
OXSM mouse monoclonal antibody,clone OTI1H6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
OXSM mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
OXSM mouse monoclonal antibody, clone OTI3A4 (formerly 3A4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
OXSM rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human OXSM |
Rabbit Polyclonal Anti-OXSM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OXSM antibody: synthetic peptide directed towards the middle region of human OXSM. Synthetic peptide located within the following region: HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP |
OXSM Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-459 of human OXSM (NP_060367.1). |
Modifications | Unmodified |