Antibodies

Jump to Filters
View as table Download
Gemin 2 (GEMIN2) Rabbit Polyclonal Antibody
TA322835

USD 380.00

In Stock

Anti-GEMIN2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 264-280 amino acids of human gem (nuclear organelle) associated protein 2
Gemin 2 (GEMIN2) Rabbit Polyclonal Antibody
TA322837

USD 380.00

In Stock

Anti-GEMIN2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 264-280 amino acids of human gem (nuclear organelle) associated protein 2
Gemin 2 (GEMIN2) Rabbit Polyclonal Antibody
TA322838

USD 380.00

In Stock

Anti-GEMIN2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 264-280 amino acids of human gem (nuclear organelle) associated protein 2
Gemin 2 (GEMIN2) Mouse Monoclonal Antibody [Clone ID: OTI4C11]
TA808769S

USD 200.00

2 Days

GEMIN2 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Gemin 2 (GEMIN2) Mouse Monoclonal Antibody [Clone ID: OTI4B3]
TA808759S

USD 200.00

2 Days

GEMIN2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Gemin 2 (GEMIN2) Rabbit Polyclonal Antibody
TA345721

USD 539.00

5 Days

Rabbit Polyclonal Anti-SIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIP1 antibody: synthetic peptide directed towards the middle region of human SIP1. Synthetic peptide located within the following region: HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
Gemin 2 (GEMIN2) Mouse Monoclonal Antibody [Clone ID: OTI6G4]
TA808823S

USD 200.00

2 Days

SIP1 mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Gemin 2 (GEMIN2) Mouse Monoclonal Antibody [Clone ID: OTI4A2]
TA808824S

USD 200.00

2 Days

SIP1 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated