Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC6A8 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC6A8

Rabbit Polyclonal Anti-SLC6A8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC6A8 antibody: synthetic peptide directed towards the N terminal of human SLC6A8. Synthetic peptide located within the following region: CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC

Rabbit polyclonal anti-SLC6A8 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human SLC6A8.

Rabbit Polyclonal Anti-SLC6A8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC6A8 antibody: synthetic peptide directed towards the middle region of human SLC6A8. Synthetic peptide located within the following region: VFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFF

SLC6A8 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 539-635 of human SLC6A8 (NP_005620.1).
Modifications Unmodified