ARPC1B rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARPC1B |
ARPC1B rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARPC1B |
Rabbit Polyclonal Anti-ARPC1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARPC1B antibody is: synthetic peptide directed towards the middle region of Human ARPC1B. Synthetic peptide located within the following region: KKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGS |
Goat Polyclonal Antibody against ARPC1B
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AYHSFLVEPISCH, from the N Terminus of the protein sequence according to NP_005711. |
Rabbit Polyclonal Anti-ARPC1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARPC1B antibody is: synthetic peptide directed towards the C-terminal region of Human ARPC1B. Synthetic peptide located within the following region: RERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTT |
ARPC1B rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARPC1B |