Rabbit Polyclonal anti-PQBP1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PQBP1 antibody: synthetic peptide directed towards the middle region of human PQBP1. Synthetic peptide located within the following region: PSCGLPYYWNADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPS |
Rabbit Polyclonal Anti-PQBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PQBP1 antibody: synthetic peptide directed towards the middle region of human PQBP1. Synthetic peptide located within the following region: LVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSH |
PQBP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human PQBP1 (NP_005701.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
