KCTD18 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KCTD18 |
KCTD18 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KCTD18 |
KCTD18 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KCTD18 |
Rabbit Polyclonal Anti-KCTD18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCTD18 antibody: synthetic peptide directed towards the N terminal of human KCTD18. Synthetic peptide located within the following region: LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN |