Antibodies

Jump to Filters
View as table Download
DDX46 Rabbit Polyclonal Antibody
TA371067

USD 380.00

4 Weeks

DDX46 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DDX46
DDX46 Rabbit Polyclonal Antibody
TA331474

USD 485.00

5 Days

Rabbit polyclonal Anti-DDX46 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the C terminal of human DDX46. Synthetic peptide located within the following region: GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL
DDX46 Rabbit Polyclonal Antibody
TA341593

USD 539.00

5 Days

Rabbit Polyclonal Anti-DDX46 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the middle region of human DDX46. Synthetic peptide located within the following region: LAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKV