IL3RA mouse monoclonal antibody, clone OTI1E12, HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
IL3RA mouse monoclonal antibody, clone OTI1E12, HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
IL3RA mouse monoclonal antibody, clone OTI10D1
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL3RA mouse monoclonal antibody, clone OTI4A10
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL3RA mouse monoclonal antibody, clone OTI10D4
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL3RA mouse monoclonal antibody, clone OTI1E12
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal IL3RA Antibody (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA. |
Rabbit Polyclonal Anti-IL3RA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL3RA antibody is: synthetic peptide directed towards the middle region of Human IL3RA. Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS |
Goat Polyclonal Anti-IL3RA / CD123 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL3RA / CD123 Antibody: Peptide with sequence RQQYECLHYKTD, from the internal region of the protein sequence according to NP_002174.1; NP_001254642.1. |