Rabbit anti-IGF1R polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanIGF-1R around the phosphorylation site of tyrosine 1161 (D-I-YP-E-T). |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
| Modifications | Phospho-specific |
Rabbit Polyclonal IGF1R Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IGF1R |
Rabbit Polyclonal IGF1R Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IGF1R |
Rabbit Polyclonal IGF1R (Tyr1161) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IGF1R around the phosphorylation site of Tyrosine 1161 |
| Modifications | Phospho-specific |
Rabbit Polyclonal IGF1R (Tyr1165/Tyr1166) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IGF1R around the phosphorylation site of Tyrosine 1165/Tyrosine 1166 |
| Modifications | Phospho-specific |
Rabbit anti-GRIA1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRIA1 |
Rabbit Polyclonal anti-GRM5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRM5 |
Rabbit Polyclonal IGF1R Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IGF1R |
Rabbit Polyclonal Anti-GRM5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRM5 Antibody: A synthesized peptide derived from internal of human GRM5. |
USD 545.00
3 Days
Ionotropic Glutamate receptor 2 (GRIA2) (+ GLUR3) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Peptide corresponding to amino acid residues from the C-terminal region of rat GluR2/3. |
Rabbit anti-IGF1R (Phospho-Tyr1165/Tyr1166) polyclonal antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanIGF-1R around the phosphorylation site of tyrosine 1165/tyrosine 1166(T-D-YP-YP-R-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-GRM1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GRM1. |
Rabbit polyclonal Glutamate receptor 2 (Ser880) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-SP-V-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Gria3 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Gria3 antibody is: synthetic peptide directed towards the middle region of Rat Gria3. Synthetic peptide located within the following region: TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM |
Germany
Japan
United Kingdom
China
