Antibodies

Jump to Filters
View as table Download
ITGB3BP Rabbit Polyclonal Antibody
TA324155

USD 380.00

In Stock

Anti-ITGB3BP Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein
ITGB3BP Rabbit Polyclonal Antibody
TA332949

USD 365.00

3 Weeks

Rabbit anti-ITGB3BP Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ITGB3BP
ITGB3BP Rabbit Polyclonal Antibody
TA334507

USD 539.00

5 Days

Rabbit Polyclonal Anti-ITGB3BP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGB3BP antibody: synthetic peptide directed towards the N terminal of human ITGB3BP. Synthetic peptide located within the following region: TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE