Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) TFRC mouse monoclonal antibody,clone OTI6H9

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal CD71 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD71 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 649-677 amino acids from the C-terminal region of human CD71.

Mouse Monoclonal TFRC (CD71) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-USP8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP8 antibody: synthetic peptide directed towards the C terminal of human USP8. Synthetic peptide located within the following region: FAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHA

Rabbit anti-TFRC Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TFRC

CD71 (TFRC) mouse monoclonal antibody, clone B-G24, FITC

Applications FC
Reactivities Human
Conjugation FITC

CD71 (TFRC) mouse monoclonal antibody, clone SOM4D10, Aff - Purified

Applications FC, IHC
Reactivities Human
Conjugation Unconjugated

CD71 (TFRC) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of Human CD71

CD71 (TFRC) mouse monoclonal antibody, clone B-G24, Azide Free

Applications FC
Reactivities Human
Conjugation Unconjugated

CD71 (TFRC) mouse monoclonal antibody, clone B-G24, Purified

Applications FC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-USP8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP8 antibody: synthetic peptide directed towards the N terminal of human USP8. Synthetic peptide located within the following region: KGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLI