TFRC mouse monoclonal antibody,clone OTI6H9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
TFRC mouse monoclonal antibody,clone OTI6H9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TFRC mouse monoclonal antibody,clone OTI6H9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
TFRC mouse monoclonal antibody,clone OTI6H9, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
TFRC mouse monoclonal antibody,clone OTI6H9, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit polyclonal CD71 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD71 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 649-677 amino acids from the C-terminal region of human CD71. |
Mouse Monoclonal TFRC (CD71) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-USP8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USP8 antibody: synthetic peptide directed towards the C terminal of human USP8. Synthetic peptide located within the following region: FAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHA |
Rabbit anti-TFRC Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TFRC |
TFRC mouse monoclonal antibody,clone OTI6H9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD71 (TFRC) mouse monoclonal antibody, clone B-G24, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD71 (TFRC) mouse monoclonal antibody, clone SOM4D10, Aff - Purified
Applications | FC, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD71 (TFRC) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of Human CD71 |
CD71 (TFRC) mouse monoclonal antibody, clone B-G24, Azide Free
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
CD71 (TFRC) mouse monoclonal antibody, clone B-G24, Purified
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-USP8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USP8 antibody: synthetic peptide directed towards the N terminal of human USP8. Synthetic peptide located within the following region: KGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLI |