Antibodies

Jump to Filters
View as table Download
TRPM4 Rabbit Polyclonal Antibody
TA338581

USD 539.00

5 Days

Rabbit Polyclonal Anti-TRPM4 Antibody

Applications WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM4 antibody: synthetic peptide directed towards the N terminal of human TRPM4. Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI