Rabbit Polyclonal Anti-CACNB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CACNB3 antibody is: synthetic peptide directed towards the C-terminal region of Human CACNB3. Synthetic peptide located within the following region: QDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDS |
Rabbit polyclonal Anti-CACNG4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL |
Rabbit Polyclonal Anti-CACNA2D4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNA2D4 antibody is: synthetic peptide directed towards the middle region of Human CACNA2D4. Synthetic peptide located within the following region: ADLNHEFNESLVFDYYNSVLINERDEKGNFVELGAEFLLESNAHFSNLPV |
Rabbit Polyclonal Anti-CACNA2D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNA2D2 antibody is: synthetic peptide directed towards the C-terminal region of Human CACNA2D2. Synthetic peptide located within the following region: NCSRLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHSDGPEQCELV |
Rabbit Polyclonal Anti-CACNB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the C terminal of human CACNB4. Synthetic peptide located within the following region: LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS |
Rabbit Polyclonal Anti-CACNB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the C terminal of human CACNB3. Synthetic peptide located within the following region: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH |
Rabbit Polyclonal Anti-CACNB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the n terminal of human CACNB3. Synthetic peptide located within the following region: MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: DYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRT |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the C terminal of human CACNB2. Synthetic peptide located within the following region: TDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHNHRSGTSRGLSRQE |
Rabbit Polyclonal Anti-CACNB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: DWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSS |
Rabbit Polyclonal Anti-Cacng3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cacng3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRARS |
Rabbit Polyclonal Anti-CACNG4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL |
Rabbit Polyclonal Anti-CACNG6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG6 antibody: synthetic peptide directed towards the N terminal of human CACNG6. Synthetic peptide located within the following region: RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: ACEHLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGS |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: AYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRTDRSA |
Germany
Japan
United Kingdom
China