Anti-GJB2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 212-227 amino acids of Human gap junction protein, beta 2, 26kDa |
Anti-GJB2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 212-227 amino acids of Human gap junction protein, beta 2, 26kDa |
Rabbit Polyclonal Anti-GJB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GJB2 antibody: synthetic peptide directed towards the N terminal of human GJB2. Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW |
GJB2 rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide mapping at the middle region of rat Connexin 26 |
Rabbit Polyclonal Anti-GJB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GJB2 antibody was raised against a 16 amino acid peptide near the center of human GJB2. |
Rabbit Polyclonal Anti-Connexin 26 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Connexin 26 Antibody: A synthesized peptide derived from the extracellular region of human Connexin 26 |