Germany
Japan
United Kingdom
China
BMP6 mouse monoclonal antibody,clone OTI8B11, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Antibodies
View as table Download
BMP6 mouse monoclonal antibody,clone OTI6G9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
BMP6 mouse monoclonal antibody,clone OTI6G9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Rabbit Polyclonal Anti-BMP6 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL |
BMP6 mouse monoclonal antibody,clone OTI1B11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI4A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI8B11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI6G9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
- Antibodies
Target Symbol
- BMP6
Reactivities
- Rat
Families
- Induced pluripotent stem cells
Pathways
- Hedgehog signaling pathway