Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit monoclonal anti-Sox2 Antibody, clone OR-4F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit polyclonal KLF5 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This KLF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 341-370 amino acids from the C-terminal region of human KLF5. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Isotypes
- IgG
Families
- Induced pluripotent stem cells
Filter by
Target Symbol
Antibody Hosts
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Pathways in cancer (27)
- MAPK signaling pathway (24)
- TGF-beta signaling pathway (17)
- Wnt signaling pathway (15)
- Acute myeloid leukemia (12)
- Endometrial cancer (12)
- Melanoma (12)
- Regulation of actin cytoskeleton (12)
- Bladder cancer (11)
- Colorectal cancer (11)
- ErbB signaling pathway (11)
- Cell cycle (10)
- Chronic myeloid leukemia (10)
- Hedgehog signaling pathway (10)
- Jak-STAT signaling pathway (10)
- Small cell lung cancer (10)
- Thyroid cancer (10)
- Basal cell carcinoma (9)
- Maturity onset diabetes of the young (9)
- Cytokine-cytokine receptor interaction (8)
- Huntington's disease (6)
- Melanogenesis (6)
- Neurotrophin signaling pathway (6)
- Cysteine and methionine metabolism (5)
- Focal adhesion (5)
- Gap junction (5)
- Metabolic pathways (5)
- Prostate cancer (5)
- Type II diabetes mellitus (4)
- Endocytosis (3)
- Hematopoietic cell lineage (3)
- Antigen processing and presentation (1)
- Cell adhesion molecules (CAMs) (1)
- Glioma (1)
- Non-small cell lung cancer (1)
- Pancreatic cancer (1)
- Primary immunodeficiency (1)
- T cell receptor signaling pathway (1)