Antibodies

View as table Download

MUM1(IRF4) mouse monoclonal antibody,clone UMAB280

Applications IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MUM1(IRF4) mouse monoclonal antibody,clone UMAB280

Applications IHC
Reactivities Human
Conjugation Unconjugated

MUM1 (IRF4) (Center) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 171-199 amino acids from the Central region of human IRF4

Rabbit Polyclonal Anti-IRF4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IRF4 Antibody: synthetic peptide directed towards the N terminal of human IRF4. Synthetic peptide located within the following region: MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIF

Rabbit Polyclonal Anti-IRF4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IRF4

Rabbit Polyclonal Anti-IRF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IRF4 Antibody: synthetic peptide directed towards the middle region of human IRF4. Synthetic peptide located within the following region: TAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE

Rabbit polyclonal anti-IRF4 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IRF4.

Goat Anti-IRF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HISNPEDYHRSIR, from the C Terminus of the protein sequence according to NP_002451.2.

Rat Monoclonal anti-IRF4 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-IRF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF4 antibody: synthetic peptide directed towards the N terminal of human IRF4. Synthetic peptide located within the following region: LDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQ

Rabbit Polyclonal Anti-IRF4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF4 Antibody: A synthesized peptide derived from human IRF4

MUM1(IRF4) mouse monoclonal antibody,clone UMAB280

Applications IHC
Reactivities Human
Conjugation Unconjugated