MUM1(IRF4) mouse monoclonal antibody,clone UMAB280
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
MUM1(IRF4) mouse monoclonal antibody,clone UMAB280
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MUM1(IRF4) mouse monoclonal antibody,clone UMAB280
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
MUM1 (IRF4) (Center) rabbit polyclonal antibody, Purified
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 171-199 amino acids from the Central region of human IRF4 |
Rabbit Polyclonal Anti-IRF4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IRF4 Antibody: synthetic peptide directed towards the N terminal of human IRF4. Synthetic peptide located within the following region: MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIF |
Rabbit Polyclonal Anti-IRF4 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IRF4 |
Rabbit Polyclonal Anti-IRF4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IRF4 Antibody: synthetic peptide directed towards the middle region of human IRF4. Synthetic peptide located within the following region: TAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE |
Rabbit polyclonal anti-IRF4 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IRF4. |
Goat Anti-IRF4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HISNPEDYHRSIR, from the C Terminus of the protein sequence according to NP_002451.2. |
Rat Monoclonal anti-IRF4 Antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IRF4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IRF4 antibody: synthetic peptide directed towards the N terminal of human IRF4. Synthetic peptide located within the following region: LDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQ |
Rabbit Polyclonal Anti-IRF4 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IRF4 Antibody: A synthesized peptide derived from human IRF4 |
MUM1(IRF4) mouse monoclonal antibody,clone UMAB280
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |