Antibodies

Jump to Filters
View as table Download
Hsp47 (SERPINH1) Rabbit Polyclonal Antibody
TA330391

USD 485.00

5 Days

Rabbit Polyclonal Anti-SERPINH1 Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINH1 antibody: synthetic peptide directed towards the C terminal of human SERPINH1. Synthetic peptide located within the following region: DIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRLKGDKMRDEL
Hsp47 (SERPINH1) Rabbit Polyclonal Antibody
TA332536

USD 365.00

2 Weeks

Rabbit anti-SERPINH1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SERPINH1
Hsp47 (SERPINH1) Mouse Monoclonal Antibody [Clone ID: 1C4-1A6]
TA326347

USD 610.00

2 Weeks

Mouse monoclonal Hsp47 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated