Antibodies

Jump to Filters
View as table Download
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA335174

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-WT1 Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WT1 antibody: synthetic peptide directed towards the middle region of human WT1. Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA326990

USD 365.00

3 Weeks

WT1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WT1