Antibodies

Jump to Filters
View as table Download
AMH Rabbit Monoclonal Antibody [Clone ID: OTIR1A3]
TA592067

USD 519.00

2 Weeks

AMH Rabbit monoclonal antibody, clone OTIR1A3

Applications ELISA
Reactivities Human
Conjugation Unconjugated
AMH Rabbit Monoclonal Antibody [Clone ID: OTIR2H6]
TA592071

USD 519.00

2 Weeks

AMH Rabbit monoclonal antibody, clone OTIR2H6

Applications ELISA
Reactivities Human
Conjugation Unconjugated
AMH Rabbit Monoclonal Antibody [Clone ID: OTIR5B9]
TA592072

USD 519.00

2 Weeks

AMH Rabbit monoclonal antibody, clone OTIR5B9

Applications ELISA
Reactivities Human
Conjugation Unconjugated
AMH Rabbit Polyclonal Antibody
TA336233

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-AMH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG
AMH (Center) Rabbit Polyclonal Antibody
AP50161PU-N

USD 580.00

2 Weeks

AMH (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 424-451 amino acids from the Central region of human AMH
AMH Rabbit Polyclonal Antibody
TA323644

USD 380.00

In Stock

Anti-AMH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 539-551 amino acids of human anti-Mullerian hormone
AMH Rabbit Polyclonal Antibody
TA310102

USD 360.00

2 Weeks

Rabbit anti-AMH polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH
AMH Rabbit Monoclonal Antibody [Clone ID: OTIR1B8]
TA592029S

USD 230.00

2 Weeks

AMH Rabbit monoclonal antibody, clone OTIR1B8

Applications ELISA
Reactivities Human
Conjugation Unconjugated
AMH Rabbit Monoclonal Antibody [Clone ID: OTIR1F8]
TA592031S

USD 230.00

2 Weeks

AMH Rabbit monoclonal antibody, clone OTIR1F8

Applications ELISA
Reactivities Human
Conjugation Unconjugated
AMH Rabbit Monoclonal Antibody [Clone ID: OTIR5C9]
TA592032S

USD 230.00

2 Weeks

AMH Rabbit monoclonal antibody, clone OTIR5C9

Applications ELISA
Reactivities Human
Conjugation Unconjugated
AMH Rabbit Monoclonal Antibody [Clone ID: OTIR1E3]
TA592033S

USD 230.00

2 Weeks

AMH Rabbit monoclonal antibody, clone OTIR1E3

Applications ELISA
Reactivities Human
Conjugation Unconjugated
AMH Rabbit Monoclonal Antibody [Clone ID: OTIR2G3]
TA592034S

USD 230.00

2 Weeks

AMH Rabbit monoclonal antibody, clone OTIR2G3

Applications ELISA
Reactivities Human
Conjugation Unconjugated
AMH Rabbit Monoclonal Antibody [Clone ID: OTIR3B3]
TA592036S

USD 230.00

2 Days

AMH Rabbit monoclonal antibody, clone OTIR3B3

Applications ELISA
Reactivities Human
Conjugation Unconjugated
AMH Rabbit Monoclonal Antibody [Clone ID: OTIR3G5]
TA592037S

USD 230.00

2 Weeks

AMH Rabbit monoclonal antibody, clone OTIR3G5

Applications ELISA
Reactivities Human
Conjugation Unconjugated
AMH Rabbit Monoclonal Antibody [Clone ID: OTIR4F7]
TA592038S

USD 230.00

2 Weeks

AMH Rabbit monoclonal antibody, clone OTIR4F7

Applications ELISA
Reactivities Human
Conjugation Unconjugated