Rabbit Polyclonal Antibody against ABCF2
Applications | ICC/IF, Simple Western, WB |
Reactivities | Human, Yeast |
Conjugation | Unconjugated |
Immunogen | A fusion protein containing amino acids 1-102 of the ABCF2 protein. |
Rabbit Polyclonal Antibody against ABCF2
Applications | ICC/IF, Simple Western, WB |
Reactivities | Human, Yeast |
Conjugation | Unconjugated |
Immunogen | A fusion protein containing amino acids 1-102 of the ABCF2 protein. |
Rabbit Polyclonal Anti-RHOC Antibody
Applications | IHC, WB |
Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |