Rabbit Polyclonal Anti-IRF4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IRF4 Antibody: synthetic peptide directed towards the N terminal of human IRF4. Synthetic peptide located within the following region: MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIF |
Rabbit Polyclonal Anti-IRF4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IRF4 |
Rabbit Polyclonal Anti-IRF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IRF4 Antibody: synthetic peptide directed towards the middle region of human IRF4. Synthetic peptide located within the following region: TAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE |
Rabbit polyclonal anti-IRF4 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IRF4. |
Rabbit Polyclonal Anti-IRF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IRF4 antibody: synthetic peptide directed towards the N terminal of human IRF4. Synthetic peptide located within the following region: LDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQ |
Rabbit Polyclonal Anti-IRF4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IRF4 Antibody: A synthesized peptide derived from human IRF4 |
Germany
Japan
United Kingdom
China
