SH3BGRL mouse monoclonal antibody,clone OTI8F7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SH3BGRL mouse monoclonal antibody,clone OTI8F7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SH3BGRL mouse monoclonal antibody,clone OTI8F7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SH3BGRL mouse monoclonal antibody,clone OTI8F7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SH3BGRL mouse monoclonal antibody,clone OTI1E5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SH3BGRL mouse monoclonal antibody,clone OTI2C7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SH3BGRL mouse monoclonal antibody,clone OTI2H5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SH3BGRL mouse monoclonal antibody,clone OTI1E5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SH3BGRL mouse monoclonal antibody,clone OTI2C7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SH3BGRL mouse monoclonal antibody, clone OTI2H5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SH3BGRL Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SH3BGRL antibody: synthetic peptide directed towards the middle region of human SH3BGRL. Synthetic peptide located within the following region: PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA |
SH3BGRL Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human SH3BGRL (NP_003013.1). |
Modifications | Unmodified |
SH3BGRL rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SH3BGRL |
SH3BGRL rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SH3BGRL |
SH3BGRL mouse monoclonal antibody,clone OTI1E5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SH3BGRL mouse monoclonal antibody,clone OTI2C7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |