Germany
Japan
United Kingdom
China
Antibodies
View as table Download
PPAR gamma (PPARG) (Isoform 1) (255 -268) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Canine, Duck, Guinea Pig, Hamster, Macaque, Mink, Mouse, Rabbit, Rat, Squirrel |
| Conjugation | Unconjugated |
| Immunogen | Synthetic Peptide corresponding to Amino acids 255 -268 of human PPAR gamma isoform 1. |
PPAR gamma (PPARG) mouse monoclonal antibody, clone 3A4A9, Ascites
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Pparg Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Pparg antibody is: synthetic peptide directed towards the C-terminal region of Rat Pparg. Synthetic peptide located within the following region: HPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYK |
PPARG (Phospho-T166) polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide derived from human PPARG around the phosphorylation site of Threonine 166. |
PPAR gamma (PPARG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Antibody R1490P was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to human PPAR gamma 1 and 2. |
PPAR gamma (PPARG) (Isoform 1) rabbit polyclonal antibody, Purified
| Applications | ELISA |
| Reactivities | Canine, Guinea Pig, Hamster, Human, Mink, Monkey, Mouse, Rabbit, Rat, Duck |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acids 255 - 268 of human PPAR gamma isoform 1. |