PPARG rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PPARG |
PPARG rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PPARG |
PPAR gamma (PPARG) (Isoform 1) (255 -268) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Canine, Duck, Guinea Pig, Hamster, Macaque, Mink, Mouse, Rabbit, Rat, Squirrel |
Conjugation | Unconjugated |
Immunogen | Synthetic Peptide corresponding to Amino acids 255 -268 of human PPAR gamma isoform 1. |
PPAR gamma Rabbit polyclonal Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PPAR-gamma. AA range:78-127 |
PPAR gamma (PPARG) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 90-120 of Human PPAR-γ. |
PPARγ Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 70-170 of human PPARγ (NP_056953.2). |
Modifications | Unmodified |
PPAR gamma Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein |
PPAR-gama polyclonal antibody
Applications | IF, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to Human PPAR-gama. |
PPAR gamma (PPARG) mouse monoclonal antibody, clone 3A4A9, Ascites
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Pparg Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Pparg antibody is: synthetic peptide directed towards the C-terminal region of Rat Pparg. Synthetic peptide located within the following region: HPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYK |
PPARG (Phospho-T166) polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic phosphopeptide derived from human PPARG around the phosphorylation site of Threonine 166. |
PPAR gamma (PPARG) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Antibody R1490P was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to human PPAR gamma 1 and 2. |
PPAR gamma (PPARG) (Isoform 1) rabbit polyclonal antibody, Purified
Applications | ELISA |
Reactivities | Canine, Guinea Pig, Hamster, Human, Mink, Monkey, Mouse, Rabbit, Rat, Duck |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 255 - 268 of human PPAR gamma isoform 1. |