Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Ippk Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ippk antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQGTS |
Rabbit Polyclonal Anti-IPPK Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IPPK antibody: synthetic peptide directed towards the middle region of human IPPK. Synthetic peptide located within the following region: KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK |
