Rabbit polyclonal anti-OPN5 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OPN5. |
Rabbit polyclonal anti-OPN5 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OPN5. |
Rabbit Polyclonal Anti-OPN5 Antibody (Transmembrane Domain)
Applications | IHC |
Reactivities | Human (Predicted: Rat) |
Conjugation | Unconjugated |
Immunogen | OPN5 antibody was raised against synthetic 17 amino acid peptide from 7th transmembrane domain of human OPN5. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Dog, Bat, Bovine, Elephant, Panda, Horse, Rabbit (100%); Gorilla, Rat (94%); Platypus (88%); Opossum, Turkey, Sparrow, Chicken (82%). |
Rabbit Polyclonal Anti-OPN5 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human (Predicted: Mouse) |
Conjugation | Unconjugated |
Immunogen | OPN5 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human OPN5. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Dog, Bovine, Elephant, Horse, Rabbit (100%); Gibbon, Mouse (94%); Bat (81%). |
Rabbit polyclonal antibody to neuropsin (opsin 5)
Applications | WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 110 and 203 of Opsin 5 (Uniprot ID#Q6U736) |
Rabbit Polyclonal Anti-OPN5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OPN5 antibody: synthetic peptide directed towards the C terminal of human OPN5. Synthetic peptide located within the following region: FFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKLTKVA |
OPN5 Antibody - C-terminal region
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human OPN5 |