JNK1 mouse monoclonal antibody,clone OTI2H6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
JNK1 mouse monoclonal antibody,clone OTI2H6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
JNK1 mouse monoclonal antibody,clone OTI4F9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI2H6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI4F9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
JNK1 mouse monoclonal antibody,clone OTI10D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI10D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-MAPK10 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 416-428 amino acids of Human mitogen-activated protein kinase 10 |
JNK1 mouse monoclonal antibody,clone OTI2H6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
JNK1 mouse monoclonal antibody,clone OTI4F9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
Applications | WB |
Reactivities | Rat, Tobacco hornworm |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Rabbit polyclonal anti-MAPK10 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAPK10. |
JNK1 mouse monoclonal antibody,clone OTI10D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |