Antibodies

Jump to Filters
View as table Download
RPL17 Rabbit Polyclonal Antibody
TA314461

USD 380.00

4 Weeks

Rabbit polyclonal anti-RPL17 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL17.
RPL17 Goat Polyclonal Antibody
TA303281

USD 520.00

5 Days

Goat Polyclonal Antibody against RPL17

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence RYSLDPENPTKSC, from the N Terminus of the protein sequence according to NP_000976.1; NP_001030178.1.
RPL17 Rabbit Polyclonal Antibody
TA335161

USD 539.00

5 Days

Rabbit polyclonal Anti-Rpl17 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rpl17 antibody is: synthetic peptide directed towards the C-terminal region of Rat Rpl17. Synthetic peptide located within the following region: APKMRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKIS