Anti-IDH3A mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | FC, IF, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Anti-IDH3A mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | FC, IF, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IDH3A mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | FC, IF, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Anti-IDH3A mouse monoclonal antibody, clone OTI5D2 (formerly 5D2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IDH3A mouse monoclonal antibody, clone OTI5D2 (formerly 5D2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-IDH3A mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
Applications | FC, IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IDH3A mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
Applications | FC, IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-IDH3A mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | FC, IF, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IDH3A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IDH3A antibody: synthetic peptide directed towards the N terminal of human IDH3A. Synthetic peptide located within the following region: MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK |
Goat Polyclonal Anti-IDH3A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IDH3A Antibody: Peptide with sequence DFTEEICRRVKDLD, from the C Terminus of the protein sequence according to NP_005521.1. |
Rabbit Polyclonal Anti-IDH3A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IDH3A antibody: synthetic peptide directed towards the middle region of human IDH3A. Synthetic peptide located within the following region: RHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRVKDL |
Anti-IDH3A mouse monoclonal antibody, clone OTI5D2 (formerly 5D2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-IDH3A mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
Applications | FC, IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |