SMAP2 mouse monoclonal antibody,clone OTI9B6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SMAP2 mouse monoclonal antibody,clone OTI9B6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMAP2 mouse monoclonal antibody,clone OTI9B6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SMAP2 mouse monoclonal antibody,clone OTI6E11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMAP2 mouse monoclonal antibody,clone OTI6E11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SMAP2 mouse monoclonal antibody,clone OTI9B6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SMAP2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 110-140 amino acids from the Central region of Human SMAP2. |
SMAP2 mouse monoclonal antibody,clone OTI6E11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-SMAP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SMAP2 antibody is: synthetic peptide directed towards the N-terminal region of Human SMAP2. Synthetic peptide located within the following region: LPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDKWKRGSE |
Rabbit Polyclonal Anti-SMAP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SMAP2 antibody is: synthetic peptide directed towards the C-terminal region of Human SMAP2. Synthetic peptide located within the following region: KVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQT |