MAPK9 (JNK2) mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
MAPK9 (JNK2) mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
MAPK9 (JNK2) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
JNK2 (MAPK9) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-JNK2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human JNK2 |
Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL |