Antibodies

Jump to Filters
View as table Download
PARP2 Rabbit Polyclonal Antibody
TA334262

USD 539.00

5 Days

Rabbit Polyclonal Anti-PARP2 Antibody

Applications IF, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PARP2 antibody: synthetic peptide directed towards the middle region of human PARP2. Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA
PARP2 Rabbit Polyclonal Antibody
TA379637

USD 365.00

3 Weeks

PARP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PARP2 (NP_001036083.1).
Modifications Unmodified