Rabbit polyclonal anti-Cullin 2 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cullin 2. |
Rabbit polyclonal anti-Cullin 2 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cullin 2. |
Rabbit anti-CUL2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CUL2 |
Anti-CUL2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 214-228 amino acids of Human cullin 2 |
Rabbit polyclonal anti-Cul2 antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 733-745 of Human Cul2 (C-terminus) coupled to KLH. |
Rabbit Polyclonal Anti-Cullin 2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cullin 2 Antibody: A synthesized peptide derived from human Cullin 2 |
Rabbit Polyclonal Anti-CUL2 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CUL2 antibody: synthetic peptide directed towards the middle region of human CUL2. Synthetic peptide located within the following region: HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA |