Rabbit Polyclonal Anti-FBXW11 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBXW11 antibody: synthetic peptide directed towards the N terminal of human FBXW11. Synthetic peptide located within the following region: CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESD |
Rabbit Polyclonal Anti-CUL2 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CUL2 antibody: synthetic peptide directed towards the middle region of human CUL2. Synthetic peptide located within the following region: HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA |
Rabbit Polyclonal Anti-TRIM32 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the N terminal of human TRIM32. Synthetic peptide located within the following region: MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEK |
Rabbit polyclonal antibody to Cullin5 (cullin 5)
| Reactivities | Human (Predicted: Mouse, Feline, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 113 and 583 of Cullin 5 (Uniprot ID#Q93034) |
Rabbit Polyclonal Phospho-BRCA1 (Ser1423) Antibody (Phospho-specific)
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BRCA1 around the phosphorylation site of Serine 1423 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-BRCA1 (Ser1524) Antibody (Phospho-specific)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BRCA1 around the phosphorylation site of Serine 1524 |
| Modifications | Phospho-specific |
Rabbit Polyclonal VHL Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VHL |
Rabbit polyclonal RFWD2(Ser387) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFWD2 around the phosphorylation site of serine 385 (T-A-SP-Q-L). |
| Modifications | Phospho-specific |
Rabbit anti-TRAF6 Polyclonal Antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TRAF6 |
Phospho-BRCA1-S988 Rabbit Polyclonal Antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S988 of human BRCA1 |
| Modifications | Phospho-specific |
Rabbit anti CDC34 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti Mekk-1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti TTK Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China