Antibodies

View as table Download

IL3RA mouse monoclonal antibody, clone OTI4A10

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

IL3RA mouse monoclonal antibody, clone OTI10D1

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

IL3RA mouse monoclonal antibody, clone OTI10D4

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI4A10

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI10D1

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI10D4

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

IL3RA mouse monoclonal antibody, clone OTI1E12

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI1E12

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

IL3RA mouse monoclonal antibody, clone OTI10D1

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

IL3RA mouse monoclonal antibody, clone OTI4A10

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

IL3RA mouse monoclonal antibody, clone OTI10D4

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit polyclonal IL3RA Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA.

Rabbit Polyclonal Anti-IL3RA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL3RA antibody is: synthetic peptide directed towards the middle region of Human IL3RA. Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS

Goat Polyclonal Anti-IL3RA / CD123 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL3RA / CD123 Antibody: Peptide with sequence RQQYECLHYKTD, from the internal region of the protein sequence according to NP_002174.1; NP_001254642.1.