Rabbit Polyclonal Anti-SYNCRIP Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SYNCRIP |
Rabbit Polyclonal Anti-SYNCRIP Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SYNCRIP |
Rabbit polyclonal anti-hnRNP Q antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human hnRNP Q. |
Rabbit Polyclonal Anti-SYNCRIP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SYNCRIP antibody: synthetic peptide directed towards the N terminal of human SYNCRIP. Synthetic peptide located within the following region: MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG |
Rabbit Polyclonal Anti-SYNCRIP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SYNCRIP antibody: synthetic peptide directed towards the middle region of human SYNCRIP. Synthetic peptide located within the following region: IEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGG |