Antibodies

View as table Download

Anti-ACY1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aminoacylase 1

Anti-ACY1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aminoacylase 1

Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAP3 antibody: synthetic peptide directed towards the N terminal of human LAP3. Synthetic peptide located within the following region: LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN

Rabbit polyclonal antibody to Aminoacylase-1 (aminoacylase 1)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Pig, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 89 and 366 of Aminoacylase 1 (Uniprot ID#Q03154)

Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Lap3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD