Antibodies

View as table Download

Rabbit Polyclonal Anti-SCN5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the C terminal of human SCN5A. Synthetic peptide located within the following region: FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM

Anti-SCN5A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1860-1874 amino acids of human sodium channel, voltage-gated, type V, alpha subunit

Anti-SCN5A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1860-1874 amino acids of human sodium channel, voltage-gated, type V, alpha subunit

Rabbit Polyclonal Anti-SCN5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the N terminal of human SCN5A. Synthetic peptide located within the following region: SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH

Rabbit polyclonal Sodium Channel-pan antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human sodium channel.

Rabbit Polyclonal Anti-SCN5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN5A antibody is: synthetic peptide directed towards the C-terminal region of Human SCN5A. Synthetic peptide located within the following region: VMSENFSRPLGPPSSSSISSTSFPPSYDSVTRATSDNLQVRGSDYSHSED