MED6 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MED6 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MED6 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MED6 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MED6 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MED6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MED6 Antibody: synthetic peptide directed towards the middle region of human MED6. Synthetic peptide located within the following region: LLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNV |
Rabbit Polyclonal Anti-MED6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MED6 antibody is: synthetic peptide directed towards the N-terminal region of Human MED6. Synthetic peptide located within the following region: ILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLH |
Rabbit Polyclonal Anti-MED6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MED6 antibody is: synthetic peptide directed towards the C-terminal region of Human MED6. Synthetic peptide located within the following region: KPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNVQQTVSAKGPPEKRMRL |
Rabbit Polyclonal Anti-MED6 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MED6 Antibody: synthetic peptide directed towards the middle region of human MED6. Synthetic peptide located within the following region: ALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKN |
MED6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 134-164 amino acids from the Central region of human MED6 |
MED6 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 214-246 amino acids from the C-terminal region of human MED6 |
MED6 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MED6 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |