IFNGR2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFNGR2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IFNGR2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IFNGR2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IFNGR2 |
IFNGR2 (C-term) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human IFNGR2 |
Rabbit Polyclonal Anti-IFNGR2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IFNGR2 antibody: synthetic peptide directed towards the middle region of human IFNGR2. Synthetic peptide located within the following region: WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL |
IFNGR2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse anti IFN gamma Monoclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |