RAB23 mouse monoclonal antibody,clone OTI2A8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAB23 mouse monoclonal antibody,clone OTI2A8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB23 mouse monoclonal antibody,clone OTI2A8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAB23 mouse monoclonal antibody,clone OTI4C7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAB23 mouse monoclonal antibody,clone OTI1A3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB23 mouse monoclonal antibody,clone OTI1A3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB23 mouse monoclonal antibody,clone OTI4C7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAB23 mouse monoclonal antibody,clone OTI2F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB23 mouse monoclonal antibody,clone OTI2F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAB23 mouse monoclonal antibody,clone OTI2A8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAB23 mouse monoclonal antibody,clone OTI1A3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAB23 mouse monoclonal antibody,clone OTI4C7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Anti-RAB23 Antibody
Applications | WB |
Reactivities | Mouse (Expected from sequence similarity: Human, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PNKQRTKKNRNP, from the C Terminus of the protein sequence according to NP_057361.3; NP_899050.1. |
Rabbit Polyclonal Anti-RAB23 Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rab23 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DPEQTHSSSNKIGVFNASVRSHLGQNSSSLNGGDVINLRPNKQRTKRTRN |
Rabbit Polyclonal Anti-RAB23 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAB23 antibody: synthetic peptide directed towards the N terminal of human RAB23. Synthetic peptide located within the following region: TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA |
RAB23 mouse monoclonal antibody,clone OTI2F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |